An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.
| ENTRAF ID | ENTRAF0160 |
| Gene name | Rv2034 |
| Uniprot ID | HTHAR_MYCTU |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Aminoacid sequence | MSTYRSPDRAWQALADGTRRAIVERLAHGPLAVGELARDLPVSRPAVSQHLKVLKTARLVCDRPAGTRRVYQLDPTGLAALRTDLDRFWTRALTGYAQLIDSEGDDT |
| FASTA file | Download |
| Length | 107 |
| Function Uniprot | Involved in the regulation of lipid metabolism and hypoxic response. Positively regulates transcription of various genes, such as phoP, groEL2 and dosR. Negatively regulates its own transcription. Acts by binding to a specific palindromic sequence motif in promoter regions. |
| Role | Activator; Repressor |
| Protein family | ArsR |
| Structure (PDB ID) | - |