An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.
| ENTRAF ID | ENTRAF0194 |
| Gene name | whiB1 |
| Uniprot ID | WHIB1_MYCTU |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Aminoacid sequence | MDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWALNTGQDSGVWGGMSEDERRALKRRNARTKARTGV |
| FASTA file | Download |
| Length | 84 |
| Function Uniprot | Acts as a transcriptional repressor, inhibiting expression in vitro. Probably redox-responsive. The apo- but not holo-form binds to its own promoter as well as that of groEL2. Oxidized apo-form and nitrosylated holo-form also bind DNA. The apo-form has been shown to act as a protein disulfide reductase, but also not to act as a protein disulfide reductase. |
| Role | Repressor |
| Protein family | Whib |
| Structure (PDB ID) | 5OAY |