An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.
| ENTRAF ID | ENTRAF0268 |
| Gene name | argR |
| Uniprot ID | ARGR_BACSU |
| Organism | Bacillus subtilis (strain 168) |
| Aminoacid sequence | MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL |
| FASTA file | Download |
| Length | 149 |
| Function Uniprot | Represses the synthesis of biosynthetic enzymes and activates the arginine catabolism. Controls the transcription of the two operons rocABC and rocDEF. |
| Role | Activator; Repressor |
| Protein family | ArgR |
| Structure (PDB ID) | 1F9N |