ENTRAF

An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.

Transcription factor information

General information

ENTRAF ID ENTRAF0426
Gene name sarA
Uniprot ID SARA_STAAU
Organism Staphylococcus aureus
Aminoacid sequence MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL
FASTA file Download
Length 124

Functional information

Function Uniprot Global regulator with both positive and negative effects that controls expression of several virulence factors and biofilm formation process in a cell density-dependent manner. In a strain-dependent manner plays a role in multidrug resistance mechanism. Is required for transcription of primary transcripts RNAII and RNAIII generated by agr (virulence accessory gene regulator) locus. Acts as a transcriptional activator of the genes encoding, among others, for fibronectin binding proteins (fnbA and fnbB), hemolysins (hla, hld, hlgB and hlgC), serine proteases (splA, splB, splD and splF) and of the bap gene, which is essential for biofilm development in some strains. Negatively regulates the expression of the genes for protein A (spa), lipase (lip), thermonuclease (nuc), immunodominant staphylococcal antigen B (isaB), staphylococcal serine and cysteine proteases (sspA and sspB), staphostatin B (sspC), metalloprotease aureolysin (aur) and collagen adhesin (cna). Probably activates the development of biofilm by both enhancing the ica operon transcription and suppressing the transcription of either a protein involved in the turnover of PIA/PNAG or a repressor of its synthesis, whose expression would be sigma-B-dependent.
Role Activator; Repressor
Protein family MarR
Structure (PDB ID) 1FZP

References

Pubmed ID 1 10411748
Pubmed ID 2 16622047
Pubmed ID 3 10411747
Pubmed ID 4 11796572
Pubmed ID 5 12753197
Pubmed ID 6 15822900
Pubmed ID 7 11196648

Experimental evidences

PDB