An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.
| ENTRAF ID | ENTRAF0428 |
| Gene name | sarR |
| Uniprot ID | SARR_STAA8 |
| Organism | Staphylococcus aureus (strain NCTC 8325) |
| Aminoacid sequence | MSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN |
| FASTA file | Download |
| Length | 115 |
| Function Uniprot | Negative regulator of sarA transcription at late exponential and stationary growth phases. It contributes to the modulation of target genes downstream of the sarA regulatory cascade. Also, positively regulates expression of primary transcripts RNAII and RNAIII generated by agr (virulence accessory gene regulator) locus. |
| Role | Activator; Repressor |
| Protein family | MarR |
| Structure (PDB ID) | 1HSJ |