An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.
| ENTRAF ID | ENTRAF0443 |
| Gene name | sinR |
| Uniprot ID | SINR_BACSU |
| Organism | Bacillus subtilis (strain 168) |
| Aminoacid sequence | MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQKEE |
| FASTA file | Download |
| Length | 111 |
| Function Uniprot | Negative as well as positive regulator of alternate developmental processes that are induced at the end of vegetative growth in response to nutrient depletion. Binds to the alkaline protease (aprE) gene at two sites. Also acts as a repressor of the key sporulation gene spo0A. Negatively regulates transcription of the eps operon, which is responsible for the biosynthesis of an exopolysaccharide involved in biofilm formation; therefore it could govern the transition between a state in which bacteria swim or swarm and a state in which bacteria assemble into multicellular communities. Acts with Hpr as a corepressor of epr expression. Also negatively regulates transcription of the lutABC operon, which is required for lactate utilization. Repressor activity is regulated by SinI. |
| Role | Activator; Repressor |
| Protein family | SinR |
| Structure (PDB ID) | 1B0N |
| Pubmed ID 1 | 1898931 |
| Pubmed ID 2 | 15661000 |
| Pubmed ID 3 | 9065689 |
| Pubmed ID 4 | 3096962 |
| Pubmed ID 5 | 8969508 |
| Pubmed ID 6 | 9384377 |
| Pubmed ID 7 | 1898931 |
| Pubmed ID 8 | 7642487 |
| Pubmed ID 9 | 15104138 |
| Pubmed ID 10 | 15661000 |
| Pubmed ID 11 | 16923912 |
| Pubmed ID 12 | 19201793 |
| Pubmed ID 13 | 9799632 |
| BPP, BCE, SM |