An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.
| ENTRAF ID | ENTRAF0602 |
| Gene name | relB |
| Uniprot ID | RELB_ECOLI |
| Organism | Escherichia coli (strain K12) |
| Aminoacid sequence | MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL |
| FASTA file | Download |
| Length | 79 |
| Function Uniprot | Antitoxin component of a type II toxin-antitoxin (TA) module. Counteracts the effect of cognate toxin RelE via direct protein-protein interaction, preventing RelE from entering the ribosome A site and thus inhibiting its endoribonuclease activity. An autorepressor of relBE operon transcription. 2 RelB dimers bind to 2 operator sequences; DNA-binding and repression is stronger when complexed with toxin/corepressor RelE by conditional cooperativity. Increased transcription rate of relBE and activation of relE is consistent with a lower level of RelB in starved cells due to degradation of RelB by protease Lon. |
| Role | Repressor |
| Protein family | RelB |
| Structure (PDB ID) | 2K29 |