ENTRAF

An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.

Transcription factor information

General information

ENTRAF ID ENTRAF0603
Gene name relE
Uniprot ID RELE_ECOLI
Organism Escherichia coli (strain K12)
Aminoacid sequence MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL
FASTA file Download
Length 95

Functional information

Function Uniprot Toxic component of a type II toxin-antitoxin (TA) module. A sequence-specific, ribosome-dependent mRNA endoribonuclease that inhibits translation during amino acid starvation (the stringent response). In vitro acts by cleaving mRNA with high codon specificity in the ribosomal A site between positions 2 and 3. The stop codon UAG is cleaved at a fast rate while UAA and UGA are cleaved with intermediate and slow rates. In vitro mRNA cleavage can also occur in the ribosomal E site after peptide release from peptidyl-tRNA in the P site as well as on free 30S subunits. In vivo cuts frequently in the first 100 codons, most frequently after the second and third base and rarely near the stop codon. Overexpression of RelE results in the inhibition of bacterial growth and a sharp decrease in colony-forming ability which is neutralized by the labile cognate antitoxin RelB. Overexpression also sharply increases persisters (cells that neither grow nor die in the presence of bactericidal agents and are largely responsible for high levels of biofilm tolerance to antimicrobials). mRNA interferases play a role in bacterial persistence to antibiotics; overexpression of this protein induces persisters resistant to ciprofloxacin and ampicillin. Plays a role in dormancy when expressed in high-density cells in the absence of antitoxin RelB; amino acid starvation and an unidentified extracellular factor promote dormancy, while expression of antitoxin RelB restores cell culturability. Acts with RelB as a corepressor of relBE transcription, considerably increasing the repression of RelB alone. 2 RelB dimers bind to 2 operator sequences; DNA-binding and repression is stronger when complexed with toxin/corepressor RelE by conditional cooperativity.
Role Repressor
Protein family ParE_toxin
Structure (PDB ID) 2KC8

References

Pubmed ID 1 26527724
Pubmed ID 2 9767574
Pubmed ID 3 12526800
Pubmed ID 4 21324908
Pubmed ID 5 15576765
Pubmed ID 6 21788497
Pubmed ID 7 22210768
Pubmed ID 8 9767574
Pubmed ID 9 19747491
Pubmed ID 10 18501926
Pubmed ID 11 22981948

Experimental evidences

BPP, GEA