ENTRAF

An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.

Transcription factor information

General information

ENTRAF ID ENTRAF0658
Gene name mazF
Uniprot ID MAZF_ECOLI
Organism Escherichia coli (strain K12)
Aminoacid sequence MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
FASTA file Download
Length 111

Functional information

Function Uniprot Toxic component of a type II toxin-antitoxin (TA) module. A sequence-specific endoribonuclease it inhibits protein synthesis by cleaving mRNA and inducing bacterial stasis. It is stable, single-strand specific with mRNA cleavage independent of the ribosome, although translation enhances cleavage for some mRNAs. Cleavage occurs at the 5'-end of ACA sequences, yielding a 2',3'-cyclic phosphate and a free 5'-OH, although cleavage can also occur on the 3'-end of the first A. Digests 16S rRNA in vivo 43 nts upstream of the C-terminus; this removes the anti-Shine-Dalgarno sequence forming a mixed population of wild-type and "stress ribosomes". Stress ribosomes do not translate leader-containing mRNA but are proficient in translation of leaderless mRNA, which alters the protein expression profile of the cell; MazF produces some leaderless mRNA. The toxic endoribonuclease activity is inhibited by its labile cognate antitoxin MazE. Toxicity results when the levels of MazE decrease in the cell, leading to mRNA degradation. This effect can be rescued by expression of MazE, but after 6 hours in rich medium overexpression of MazF leads to programmed cell death. MazF-mediated cell death occurs following a number of stress conditions in a relA-dependent fashion and only when cells are in log phase; sigma factor S (rpoS) protects stationary phase cells from MazF-killing. Cell growth and viability are not affected when MazF and MazE are coexpressed. Both MazE and MazE-MazF bind to the promoter region of the mazE-mazF operon to inhibit their own transcription. MazE has higher affinity for promoter DNA in the presence of MazF. Cross-talk can occur between different TA modules, ectopic expression of this toxin induces transcription of the relBEF TA module operon with specific cleavage of the mRNA produced.
Role Repressor
Protein family PemK_toxin
Structure (PDB ID) 1UB4

References

Pubmed ID 1 26527724
Pubmed ID 2 18854355
Pubmed ID 3 15537630
Pubmed ID 4 23280569
Pubmed ID 5 21944167
Pubmed ID 6 8650219
Pubmed ID 7 11222603
Pubmed ID 8 15150257
Pubmed ID 9 19251848
Pubmed ID 10 25564525
Pubmed ID 11 23432955

Experimental evidences

SM, GEA