An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.
| ENTRAF ID | ENTRAF0659 |
| Gene name | mazE |
| Uniprot ID | MAZE_ECOLI |
| Organism | Escherichia coli (strain K12) |
| Aminoacid sequence | MIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEPVFTLAELVNDITPENLHENIDWGEPKDKEVW |
| FASTA file | Download |
| Length | 82 |
| Function Uniprot | Antitoxin component of a type II toxin-antitoxin (TA) module. Labile antitoxin that binds to the MazF endoribonuclease toxin and neutralizes its endoribonuclease activity. Is considered to be an 'addiction' molecule as the cell dies in its absence. Toxicity results when the levels of MazE decrease in the cell, leading to mRNA degradation. This effect can be rescued by expression of MazE, but after 6 hours in rich medium the overexpression of MazF leads to programmed cell death. Cell growth and viability are not affected when MazF and MazE are coexpressed. Both MazE and MazE-MazF bind to the promoter region of the mazE-mazF operon to inhibit their own transcription. There are 3 operators to which MazE binds. MazE has higher affinity for promoter DNA in the presence of MazF. |
| Role | Repressor |
| Protein family | MazE_antitoxin |
| Structure (PDB ID) | 1MVF |