An Encyclopedia of well-annotated DNA-binding TRanscription factors in Bacteria and Archaea.
| ENTRAF ID | ENTRAF0666 |
| Gene name | dinJ |
| Uniprot ID | DINJ_ECOLI |
| Organism | Escherichia coli (strain K12) |
| Aminoacid sequence | MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQSIKNSEAGIDVHKAKDADDLFDKLGI |
| FASTA file | Download |
| Length | 86 |
| Function Uniprot | Antitoxin component of a type II toxin-antitoxin (TA) module. A labile antitoxin that counteracts the effect of cognate toxin YafQ. YafQ and DinJ together bind their own promoter, and repress its expression. There are 2 operators with imperfect inverted repeats (IR) in the dinJ promoter, YafQ-(DinJ)2-YafQ only binds to the first (most upstream) of them to repress transcription; binding to a single IR is sufficient for activity in vivo and in vitro. DinJ alone is as potent a transcriptional repressor as the heterotetramer and also only needs to bind 1 IR to act. |
| Role | Repressor |
| Protein family | RelB |
| Structure (PDB ID) | 4Q2U |